| Synonyms | Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine. |
| Introduction | Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein （373-amino acid） with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22. |
| Description | Fractalkine Human Recombinant- produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton.
The Fractalkine is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered White lyophilized （freeze-dried） powder. |
| Formulation | The CX3CL1 was lyophilized from a 0.2μm filtered concentrated （1.0 mg/ml） solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl. |
| Solubility | It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein （0.1% HSA or BSA）.
Please prevent freeze-thaw cycles. |
| Purity | Greater than 97.0% as determined by（a） Analysis by RP-HPLC.
（b） Analysis by SDS-PAGE. |
| Amino acid sequence | QHHGVTKCNITCSKMTSK*ALLIHYNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG. |
| Biological Activity | The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml. |
| Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
