| Synonyms | Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15. |
| Introduction | CCL15, a new human CC chemokine, was isolated from a human fetal spleen cDNA library. CCL15 cDNA encodes a predicted 113 amino acid （aa） protein containing a putative signal peptide of 21 amino acids that is cleaved to generate a 92 aa residue mature protein. Within the CC family members, human CCL15 shares 45%, 44%, 35%, and 30% aa homology with mouse C10, human MPIF-1, human HCC-1, and mouse MIP-1?, respectively. The gene for MIP-5 is found on chromosome 17 where the genes for most of the human CC chemokines are located. Human CCL15 is expressed in T and B lymphocytes, NK cells, monocytes and monocyte-derived dendritic cells. Human MIP-5 is chemotactic for T cells and monocytes and has been shown to induce calcium flux in human CCR-1-transfected cells. |
| Description | Macrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa.
The MIP5 is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered White lyophilized （freeze-dried） powder. |
| Formulation | MIP5 was lyophilized from a concentrated （1mg/ml） solution containing 20mM PBS pH-7.4 and 100mM NaCl. |
| Solubility | It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein （0.1% HSA or BSA）.
Please prevent freeze-thaw cycles. |
| Purity | Greater than 97.0% as determined by（a） Analysis by RP-HPLC.
（b） Analysis by SDS-PAGE. |
| Amino acid sequence | QFINDAEMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI. |
| Biological Activity | Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1 -10 ng/ml. |
| Usage | Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
